PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33645.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 704aa    MW: 78056.3 Da    PI: 6.5871
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33645.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.61.2e-28434485152
      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 aek+isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  KHN33645.1 434 AEKTISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 485
                 589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.257424505IPR003035RWP-RK domain
PfamPF020423.2E-24438485IPR003035RWP-RK domain
SuperFamilySSF542772.62E-23596691No hitNo description
Gene3DG3DSA:3.10.20.2404.0E-22605686No hitNo description
PROSITE profilePS5174523.9606689IPR000270PB1 domain
SMARTSM006662.1E-26606689IPR000270PB1 domain
PfamPF005643.3E-16606688IPR000270PB1 domain
CDDcd064071.42E-39607688No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MVGKRWWIGP RENPGPSSSV KERLVIAVGY LKEYAKNSNL LIQVWVPERR RSARAQPQDN  60
YPYAALLNTT SAFQFQEDWV HDQWTPNIRF FRSHEYPRHL RRPGSLALPV FESGSAMCLG  120
VVEILMPNNP DLHALQSVDF TSSTCHQNFI PPAAVTAKGF DELYQSALNE IVEVLTCVCK  180
AHNLPLALTW APCIQQGKSG CGHSNDENYV SMVDPASFVA DVEVLGFLEA CSECHLLGGQ  240
GVVGTAFTTT KPCFANDITA FSKAEYPLAH HANMFGLHAA VAIPLLSDSA DFVLEFFLPK  300
DCHDTQEQKQ MLNSLSMLVQ QACRSLHVVM GKEEEEEEEE EELIALPPVG KEMESSSSSS  360
WIAHMMEAQQ KGKGVSVSLE YLQEPKQEFR VTTNCNEQVS VGVESGGGEE SYTAAFGGRR  420
GARKSAGDKR RTKAEKTISL PVLRQYFAGS LKDAAKSIGV CPTTLKRICR QHGITRWPSR  480
KIKKVGHSLR KLQLVIDSVQ GAEGAIQIGS FYTSFPELSS ANGVSESSNI NNKFFSEYNQ  540
GATTFKSPTS PCSQTTILIS ENQQPLVLGA SIQVQEEAKH FAHHLEPLPP APLPQSSTSL  600
WNTAGTFRVK ATFGDEKIRF SLQPNWGFRD LQMEIARRFN LNEISNIQLK YLDDAREWVL  660
LTCDADLDEC KDINTSSQSR TIRLFLFQAS PLNHANAFRG TSPS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-160AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523488.10.0PREDICTED: protein NLP2-like
RefseqXP_014629858.10.0PREDICTED: protein NLP2-like
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLA0A0B2RK800.0A0A0B2RK80_GLYSO; Protein NLP2
STRINGGLYMA04G00210.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]